Стальные волосы: Стальной цвет волос [палитра металлических оттенков и 22 фото]

Содержание

Силуэт — профессиональная красота

13/04/18


Если раньше  окрашивание в один тон и «натуральность» волос  приветствовались, то сейчас молодёжные тенденции изменились в корне!


Весной 2018 году ведущие стилисты призывают современных красоток не бояться экспериментировать с цветом волос.


Насыщенные цветные цвета волос на пике популярности. Мы можем встретить их на всех  весенне-летних показах!


Яркое окрашивание это способ поменять своей естественный оттенок тем, кого природа одарила не подходящим цветом волос! Креативные техники дают возможность осуществить  окрашивание волос 2018 на прядях разного цветотипа.

Девушкам со светлыми прядями могут загореться идеей выбрать окрашивание в пепельном, медовом  тоне или оливковом цвете! 


Русоволосые барышни могут позволить себе «клубничный» блонд  (или как его еще называют «ягодный»), а также цвет карамели!


Темноволосые модницы отдают предпочтение выразительным насыщенным оттенкам,медно-красным,вишневому переливу и цвету марсала. 


Давайте посмотрим подробнее основные тренды ОКРАШИВАНИЯ 2018:


ЯРКОЕ ОКРАШИВАНИЕ


В 2018 удивил всех тренд окрашивание голубого, синего, розового и фиолетового оттенков,цвета фуксия,а также сочетания пастельных и оттенков «вырви глаз».

Стилисты окрашивают в двух тонах, играя с оттенками. Для реализации этого способа волосы предварительно можно высветлить на кончиках, на которых после нанесения тона волосы наиболее насыщенные и яркие.



«GALAXY HAIR»
Лента в инстаграм многих модниц снова окрасилась в яркие цвета – на этот раз благодаря новому тренду в окрашивании волос, который называется «Galaxy hair».  Мастера, вдохновившись красотой космоса, комет, далеких планет окрашивают пряди «космическими» градиентами в голубых, красных, фиолетовых  и зеленых тонах.

Для того, чтобы создать подобные космические переливы на своих волосах лучше всего обратиться к грамотному колористу, который сможет создать все тонкие переходы цветов и оттенков, при этом не испортив волосы. Главный залог успеха галактических волос  — здоровые волосы, так как яркое колорирование будет не эстетично смотреться на безжизненных волосах.

ПИКСЕЛЬНОЕ ОКРАШИВАНИЕ


Новым, стремительно набирающим популярность трендом этого года стал способ окрашивания в разные цвета и сложные геометрические формы, который назвали пиксельным. Навыками окрашивания в пиксели владеют немногие колористы, но недавно в Студии «Силуэт» проходил мастер-класс от стилиста академии ESTEL Никиты Кавлакана,где мастера обучались пиксельному окрашиванию. Фотоотчет смотреть ЗДЕСЬ

Пиксельное окрашивание круто смотрится по всей длине волос, на корнях или локально на челке. Абсолютно точно такая техника выделит ее обладательницу из толпы.


СЕКРЕТНОЕ (СКРЫТОЕ) ОКРАШИВАНИЕ 


Скрытое окрашивание уже наступает на пятки любому радужному окрашиванию! Основной тон волос остается естественным, но внутри — на виске, затылке — выглядывают «кислотные» сочные цвета: салатовый, оранжевый, розовый, фиолетовый, синий и др. Главный нюанс— пряди  должны быть ядовито-яркими,т.к. в обычной жизни такие детали не видно под верхней частью волос. Между прочим, это очень удобно, в офис вы можете прийти со спокойным цветом,а вечером на party показать свой образ во всей красе.



ЯГОДНЫЙ БЛОНД


Переходя от кислотных цветов  к нежным оттенкам, бьюти-стилисты могут предложить вам «ягодный блонд» (или «клубничный» блонд). Это очень изысканно и романтично, ведь многогранность цвета проявляется в том,что это могут быть и розовый тон, и пшеничный и медовый и даже золотой. Девушки без проблем смогут подобрать себе подходящий вариант оттенка!



*Внимание! Только профессиональный колорист может сделать качественное окрашивание «ягодный блонд»


«СТАЛЬНЫЕ» ВОЛОСЫ


Среди маст-хэв окрашиваний 2018 этой весной будут особенно популярны все серые оттенки «Silverhair», «Grannyhair» — серебристые, антрацитовые, графитовые, стальные, перламутровые, оттенки асфальта. Как правило, это балаяж или холодное однотонное окрашивание  с градиентом от белого к серому,от серебряного цвета к перламутровому. Очень классно смотрится на молодых и юных девушках,но при условии, что у них густая копна и теплая кожа с медовым тоном. Если обладательница «стальных волос» имеет карие глаза,зеленые или серые глаза, то она будет бесподобна.  



Однако сейчас стилисты предлагают совсем неординарные подходы к окрашиванию!  Стилисты смешивают оттенки между собой с помощью различных техник окрашивания.Например, мелирование сочетают с омбре  и балаяжем, «Галактику» с радужным окрашиванием  и получают интересные переходы и блики, где решения смотрятся весьма оригинально!


*Внимание! Перед самостоятельным окрашиванием обязательно проконсультируйтесь с опытным колористом!

Лак для волос Got2B Стальная хватка (100 мл)


Не является публичной офертой

Производитель:
Бренд:
Страна:

ГЕРМАНИЯ

Вес брутто: 106 г.
Объём: 333 см3.
Штрихкод: 4015100404586
Куплено штук: 5
Остаток:
В коробке:

Описание

Забетонируй̆ свой экстремальный̆ стайлинг с помощью лака got2b стальная хватка. Вызывающая фиксация укладки. Твои волосы сохранят форму — пока не вымоешь. Укладка – высший̆ класс!
• Цементирование.
• Форма.
• Фиксация 6.

dimethyl ether ◊ alcohol denat. (37,2 % vol.) ◊ aqua ◊octylacrylamide/acrylates/butylaminoethyl methacrylate copolymer ◊ aminomethyl propanol ◊ parfum

Опасно. Легко воспламеняется. Баллон находится под давлением. Предохранять от воздействия прямых солнечных лучей и нагревания свыше 50°C. Не вскрывать и не сжигать баллон даже после использования. Не распылять вблизи открытого огня и раскаленных предметов. Держать на расстоянии от источников возгорания. Не курить. Хранить в местах, недоступных для детей. Избегать попадания в глаза и на поврежденную кожу. Использовать в хорошо проветриваемых помещениях. Распылять короткими нажатиями. Не содержит озоноразрушающих веществ. Использование в пищевых целях опасно для жизни и здоровья.

12 советов, на которые стоит обратить внимание, при выборе щипцов для завивки волос

Какое покрытие самое лучшее? Какая форма насадки – универсальная? Много насадок – хорошо или плохо? Выбирая щипцы
для волос, девушки сталкивают с массой вопросов. На часть из них мы постарались ответить в нашем материале.

1. Покрытие пластин

Есть плойки обычные, стальные, а есть со специальными покрытиями, которые не дают вашим волосам пересушиваться.
А это довольно важный параметр, если вы часто завиваетесь. Поэтому имеет смысл выбирать вариант самый
щадящий для волос. Самые лучшие защитные покрытия: турмалиновые и керамические.

2. Регулировка температуры.

Никогда не берите плойку, в которой нет этой функции. Для разных типов волос, да и для разных видов укладок,
нужны и режимы различные. Хорошая плойка лишь та, где диапазон температур от 50С до 200С.

3. Диаметр насадки.

Вообще, прежде чем выбрать в магазине какую-либо модель, стоит сходить в салон красоты и поэксперементировать
с различными видами кудрей. Может, вам совсем не понравятся большие локоны, а вы уже купите плойку с
соответствующим диаметром. Как вы понимаете, чем тоньше стержень, тем Уже будет спиралька и наоборот.

4. Форма насадки.

Если говорить о плойках, предназначенных для создания обычного локона, то лучше всего удаётся сделать их
с помощью конусообразной насадки. С ней причёска выглядит более естественно.

5. Длина насадки.

Чем у вас длиннее волосы, тем длиннее должна быть и насадка. Иначе вам придётся остаток волос, которые не
поместились на спираль, накладывать поверх первого слоя, и они очень слабо накрутятся.

6. Наличие подставки на ножке.

Без этой мелочи плойку очень сложно класть в процессе завивки, она ж горячая и может повредить поверхность.

7. Наличие петельки для подвешивания.

Такие плойки очень просто хранить, и они не повредятся от удара, если вы случайно положите что-то в шкаф.
Особенно важно это для плоек с керамическим покрытием, так как они достаточно хрупкие.

8. Наличие насадок.

Не стоит брать модель, которая имеет множество насадок. Стоит она всё равно в пару раз дороже, а пользоваться
всеми вы не станете, проверено не раз. Лучше купить пару плоек с разными наконечниками, так как они более
надёжны и долговечны. Места крепления насадок самые уязвимые и со временем они ломаются.

9. Длина шнура.

Какой бы ни была с виду хорошей плойка, но если она снабжена коротким шнуром, не берите её. Очень неудобно таскать за собой удлинитель с массивной розеткой. Шнур должен быть от 2 до 3 метров, это самый оптимальный вариант, так как, если взять совсем уж длинный шнур, то он будет путаться.

10. Вращение шнура вокруг своей оси.

Очень удобная функция, которой не стоит пренебрегать.

11. Таймер отключения готовности локонов.

Очень удобная вещь, которая не даст вам зазеваться и ненароком сжечь прядь.

12. Таймер отключения противопожарный.

Такие модели можно спокойно бросить включенными и не переживать, что в доме может случиться пожар.

Оттеночный бальзам Тоника «Стальной» (Для блондированных и светлых волос)

ПОСМОТРЕТЬ ПОДРОБНОЕ ОПИСАНИЕ (нажмите, чтобы открыть)

Бренд №1 в категории оттеночные средства

Оттенки для блондированных и светлых волос соответствует современным трендам, линейка состоит из большого разнообразия блонда с разными цветовыми нюансами — кристально-чистые холодные тона, теплые с золотистым отливом и пастельно-розовые с легким сиянием жемчуга.

Благодаря сочетанию идеально подобранных пигментов, оттеночный бальзам для волос обеспечивает бережное тонирование. Активные компоненты облегчают расчесывание и увлажняют волосы.

  • Бальзамная основа, стойкий цвет. Постепенно смывается при мытье головы шампунем.
  • Содержит натуральные компоненты: Льняное масло, Экстракт семени льна, витамин F.
  • Без аммиака, формальдегидов, персульфатов, перекиси и спирта.

СПОСОБ ПРИМЕНЕНИЯ

Пользуйтесь перчатками, а также защищайте одежду полотенцем. Нанесите жирный крем по линии роста волос и на уши во избежание окрашивания кожи. Нанесите оттеночный бальзам на чистые влажные волосы и равномерно распределите.

Время выдержки на волосах:

  • До 5 минут для поддержания цвета;
  • До 10 минут для получения легкого оттенка;
  • До 30 минут для более насыщенного оттенка.
  • Для сильно осветленных волос рекомендуем разбавить оттеночный бальзам с обычным бальзамом в пропорции 1/3 (1 часть — Тоника, 3 части — обычный бальзам). Время выдержки до 5 минут.

По истечении времени промойте волосы теплой водой, пока не станет прозрачной. Закрепите полученный результат разбавленным лимонным соком (1/2 лимона на 200 мл воды). Воспользуйтесь бальзамом для окрашенных волос.

Важно подобрать необходимый способ применения и нужное время выдержки в зависимости от степени осветления волос. Перед окрашиванием рекомендуется провести тест на отдельной пряди, отметив время проявления желаемого результата. Цвет оттеночного бальзама может отличаться от оттенка на волосах, который получится в результате. 

Состав: Aqua, Cetearyl Alcohol, Propylene Glycol, Sodium Laureth Sulfate, Ceteareth-23, Ethoxydiglycol, Silicone Quaternium-18, Trideceth-6, Trideceth-12, Parfum, Hydrolyzed Keratin, Vitis Vinifera (Grape) Seed Oil, Bambusa Vulgaris (Bamboo) Extract, Bombyx Mori (Silk) Еxtract, Gossypium Herbaceum (Cotton) Extract, Tocopheryl Acetate, Citric Acid, Ethylhexyl Methoxycinnamate, Butyl Methoxydibenzoylmethane, PPG-26-Buteth-26, Ethylhexyl Salicylate, PEG-40 Hydrogenated Castor Oil, Methylchloroisothiazolinone, Methylisothiazolinone, Butylphenyl Methylpropional, Disperse Violet 1, Basic Blue 99.

Цвет волос Stella Steel Blue

Цвет волос Stella Blue Blue | Краска для волос Herman`s Professional

/ Готовы преобразить свои волосы?

https://www.hermanshaircolor.com/product/27/stella-steel-blue-hair-color27Stella- Steel Blue Hair Color12.9EURInStock

Stella Steel Blue — это смесь светло-серебристо-синего цвета. Оставьте краску для волос на 30 минут или более интенсивных, более стойких результатов, оставьте цвет на 1-2 часа и не волнуйтесь, кондиционер для волос не повредит ваши волосы, но глубоко кондиционирует их.

Для достижения наилучших результатов начните с чистых, ухоженных и сухих волос. Чтобы получить полное покрытие от предварительно обесцвеченных платиновых до средних светлых волос, мы рекомендуем наши собственные Herman’s Amazing Bleach Kit для осветления волос.

Herman’s Amazing — это полуперманентная краска для волос прямого действия, на основе кондиционеров, полностью веганская и не содержащая жестокого обращения.Красивые яркие цвета для волос, которые не повредят ваши волосы. Краска для волос действует мягко, глубоко кондиционируя волосы во время окрашивания, и тускнеет естественным образом.

— На основе кондиционера, без аммиака

— Цвет остается примерно 8–12, результаты могут отличаться

— Всегда делайте тест на заплатку и прядь заранее

— 100% веганы и без жестокого обращения

— Лучшие результаты для предварительно осветленных или светло-светлых волос

— Цвета, подходящие для самостоятельного изготовления / смешанные цвета

Для достижения наилучших и стойких результатов следуйте нашим инструкциям по окрашиванию:

  • Вымойте волосы накануне и не используйте кондиционер или другие средства по уходу за волосами, это поможет цвету более естественным образом соединиться с вашими волосами и продержится дольше.
  • Естественные темные или седые волосы необходимо осветлить и раскрыть путем обесцвечивания перед окрашиванием.
  • Краски для волос могут вызывать аллергические реакции, если вы ранее испытывали аллергическую реакцию при окрашивании волос, перед окрашиванием волос сделайте выборочную пробу на коже.
  • Хорошо расчешите волосы. Этот шаг упростит нанесение краски.
  • Смажьте линию роста волос, уши и шею вазелином или кремом перед нанесением краски на волосы.
  • Хорошо встряхните банку, прежде чем открывать ее.
  • Используйте перчатки для защиты.
  • Начните наносить краску для волос на корни и двигайтесь вниз. Вы также можете использовать кисть для удобного нанесения. Главное — убедиться, что ваши волосы полностью покрыты.
  • Когда ваши волосы полностью покрыты, оставьте краску на волосах на 30-40 минут. Чем дольше вы держите его, тем ярче станет цвет.
  • Сотрите излишки краски с шеи и лба бумажным полотенцем или влажной тканью.
  • Когда время истечет, ополосните волосы теплой водой, пока вода не станет прозрачной. Затем нанесите защитный кондиционер. Это поможет сохранить ваш цвет и ощущение сияния, мягкости и шелковистости.
  • Вы можете сохранить оставшийся цвет.

Herman’s Amazing готов к использованию; не смешивайте с проявителями, осветлителями или стойкими красками для волос. Может временно окрашивать кожу и навсегда оставлять пятна на ткани.

12.9Немецкий профессионал https://www.hermanshaircolor.com/tuotekuvat/900×900/_MG_4837.JPG//

Цвет волос Stella Steel Blue

Цена
12,90 €
Наличие
В наличии

Stella Steel Blue — смесь светло-серебристо-синего цвета. Оставьте краску для волос на 30 минут или более интенсивных, более стойких результатов, оставьте цвет на 1-2 часа и не волнуйтесь, кондиционер для волос не повредит ваши волосы, но глубоко кондиционирует их.

Для достижения наилучших результатов начните с чистых, ухоженных и сухих волос. Чтобы получить полное покрытие от предварительно обесцвеченных платиновых до средних светлых волос, мы рекомендуем наш собственный набор Herman’s Amazing Bleach Kit для осветления волос.

Herman’s Amazing — это полуперманентная краска для волос прямого действия, на основе кондиционеров, 100% веганская и не содержащая жестокого обращения. Красивые яркие цвета для волос, которые не повредят ваши волосы. Краска для волос действует мягко, глубоко кондиционируя волосы во время окрашивания, и постепенно тускнеет.

— На основе кондиционера, без аммиака

— Цвет остается примерно 8-12, результаты могут отличаться

— Всегда предварительно проводите тест на заплатку и прядь

— 100% веганские продукты без жестокого обращения

— Лучшие результаты для предварительно осветленных до светло-русых волос

— Цвета, подходящие для самостоятельного использования / смешанные цвета

Для достижения наилучших и стойких результатов следуйте нашим инструкциям по окрашиванию:

  • Вымойте волосы накануне и избегайте использования кондиционера или других средств по уходу за волосами, это поможет цвету более естественным образом смешаться с вашими волосами и продержится дольше.
  • Естественные темные или седые волосы перед окрашиванием необходимо осветлить и раскрыть путем обесцвечивания.
  • Краски для волос могут вызывать аллергические реакции. Если вы ранее испытывали аллергическую реакцию при окрашивании волос, перед окрашиванием проведите спот-тест на коже.
  • Хорошо расчешите волосы. Этот шаг упростит нанесение краски.
  • Смажьте линию роста волос, уши и шею вазелином или кремом перед нанесением краски на волосы.
  • Хорошо встряхните банку, прежде чем открывать ее.
  • Используйте перчатки для защиты.
  • Нанесите краску на корни и двигайтесь вниз. Вы также можете использовать кисть для удобного нанесения. Главное — убедиться, что ваши волосы полностью покрыты.
  • Как только ваши волосы будут полностью покрыты, оставьте краску на волосах на 30-40 минут. Чем дольше вы держите его, тем ярче станет цвет.
  • Вытрите излишки краски с шеи и лба бумажным полотенцем или влажной тканью.
  • Когда время истечет, ополосните волосы теплой водой, пока вода не станет прозрачной.Затем нанесите защитный кондиционер. Это поможет сохранить ваш цвет сияющим, мягким и шелковистым.
  • Оставшийся цвет можно сохранить.

Herman’s Amazing готов к использованию; не смешивайте с проявителями, осветлителями или стойкими красками для волос. Может временно испачкать кожу и навсегда испачкать ткань.

Включает 115 мл цвета.

Состав:
Вода, цетеариловый спирт, метосульфат дистеароилэтилгидроксиэтилмония, цетеарет-20, лимонная кислота, феноксиэтанол, метилпарабен, этилпарабен, бутилпарабен, пропилпарабен, кислотный фиолетовый 43, основной синий 99, основной коричневый 16, основной красный 76, основной желтый 57, основной синий 124, Basic Violet 2, Basic Violet 16, HC Blue №15.

Back to Top

Oway Серебряная стальная ванна для волос — Holistic Hair Tribe

• Нейтрализует нежелательные золотисто-желтые тона
• Укрепляет и оживляет все типы волос
• Обеспечивает невесомое увлажнение для мягких, блестящих волос.
• Бодрящие эфирные масла обеспечивают ароматерапию, бодрящую для волос и разума
• Упакованы в бесконечно перерабатываемое роскошное янтарное стекло для защиты целостности ингредиентов
• Веганские, без жестокого обращения и без глютена

Не содержит:

  • ✕ Парабены
  • ✕ SLS / SLES
  • ✕ ГМО
  • ✕ Нефть
  • ✕ Фталаты
  • ✕ Синтетический ароматизатор
  • ✕ PEG, PPG и BG
  • ✕ Искусственные красители

ВОСКРЕСИТЕЛЬНЫЙ ЗАВОД: Это необычное растение способно выживать в чрезвычайно суровых и засушливых условиях из-за присутствия сахара, называемого трегалозой.Эта молекула защищает организмы от экстремальных условий, стабилизируя белки и сохраняя клеточные мембраны. В свою очередь, это оказывает регенерирующее, антиоксидантное, увлажняющее и защитное действие на волосы, кожу и кожу головы.

Среда обитания: мексиканская пустыня

ORGANIC MAQUI: Также называемая патагонской голубикой, она считается самой мощной супер-ягодой, встречающейся в природе. Этот фрукт содержит дельфинидин, который производит клеточную энергию и замедляет процессы старения.

Место обитания: Патагония.

ЭТИЧЕСКОЕ МАСЛО БАКУРИ: Богатое витаминами A, B и C, антиоксидантами и минералами, это чрезвычайно питательное и естественное смягчающее средство для кожи и волос.

Среда обитания: тропический лес.

ЦЕОЛИТ: Оказывает антистрессовое, реминерализирующее и детоксифицирующее действие на кожу головы. Это особенно эффективно для чувствительной кожи.

Среда обитания: вулканические почвы.

СИБИРСКИЙ ЖЕНСЕНЬ: Богат фитонутриентами, которые тонизируют, осветляют и наполняют кожу энергией.Известен своими антивозрастными свойствами.

Место обитания: Сибирь и Монголия.

БИОФЕРМЕНТЫ: Эти замечательные техно-ботанические вещества обеспечивают волосы и кожу необходимыми питательными веществами. Они усиливают клеточную сплоченность тканей, делая их более прочными и компактными. Они также стимулируют восстановление и регенерацию кожи.

ФИТО-ПЕПТИДЫ: Еще один инновационный техно-ботанический препарат, его небольшой молекулярный вес обладает способностью глубоко кондиционировать и восстанавливать волокна волос изнутри.Его полностью естественное омолаживающее и уплотняющее действие придает волосам силу, объем и структуру.

ГИАЛУРОНОВАЯ КИСЛОТА ИЗ РАСТЕНИЙ: Повышает гидратацию клеток, повышает эластичность кожи, уменьшает морщины, уплотняет и уплотняет кожу.

ПОЛНЫЕ ИНГРЕДИЕНТЫ: (ND) Естественное происхождение | (O) Органический | (BD) Биодинамика | (EO) Эфирное масло | (FT) Справедливая торговля | (NI) Идентичный натуральный ингредиент | (PS) Консервантная система

ВОДА (Н. ) , ORYZA SATIVA (RICE) EXTRACT (B) , PISUM SATIVUM (PEA) PEPTIDE SATIVUM (PEA) (ND) , LEUCONOSTOC / RADISH ROOT FERMENT FILTRATE (ND) , SODIUM BABACETATE AMP , КОКО-ГЛЮКОЗИД (Н. (EO) , МАСЛО ЛИСТА ЭВКАЛИПТА ГЛОБУЛУСА (EO) , МАСЛО ПИЛИНГА ЦИТРУСА SINENSIS EXPRESSED (EO) , МАСЛО ЦИТРУСА АУРАНТИФОЛИЯ (ЛАЙМ) (EO) , МАСЛО ЛАУРА НОБИЛИСА (МАСЛО ЛАУРА НОБИЛИСА) ( ЦВЕТОЧНОЕ МАСЛО GRAVEOLENS (EO) , CINNAMOMUM CAMPHORA (CAMPHOR) BAR K OIL (EO) , CITRUS AURANTIUM BERGAMIA (BERGAMOT) FRUIT OIL (EO) , JUNIPERUS VIRGINIANA OIL (EO) , ЭКСТРАКТ ЦВЕТОВ CANANGA ODORATA (ND) , ORANGE OIL , ORANGE OIL (EO) , ЭКСТРАКТ ЛИСТА VERBENA OFFICINALIS (ND) , CITRUS AURANTIFOLIA (LIME) PEEL OIL (EO) , ACACIA DECURRENS DEALBATA FLOWER EXTRACT (ND) , SANTALUM ALBUM) (SANDAL22WOOD) , JASMINUM OFFICINALE (JASMINE) OIL (EO) , CITRUS AURANTIUM FLOWER OIL (EO) , ROSA DAMASCENA FLOWER OIL (EO) , LAVANDULA ANGUSTIFOLIA (LAVENDER) OIL (EO) (EO) EO) , LAVENDER HYBRIDA OIL (EO) , GLYCERYL OLEATE (ND) , CI 60730 (EXT.ФИОЛЕТ 2), ПОЛИКВАТЕРНИЙ-10, ГИДРОГЕНИРОВАННЫЙ ЦИТРАТ ГЛИЦЕРИДОВ ЛАУРЕТЫ (ND) , ДИЗОДИЙ ЛАУРЕТА СУЛЬФОСУЦЦИНАТ (ND) , ДИСТЕАРАТ ГЛИКОЛЯ (НОДА ЦИТРАЛЬНАЯ КИСЛОТА (ND) , ЦИТРАЛЬНАЯ КИСЛОТА (ND) ) , БЕНЗОАТ НАТРИЯ

Серебряная стальная ванна для волос
— NVBL

Заголовок по умолчанию — 36 долларов США.

  • В наличии всего 7 штук!

    [{«id»: 3228358

    16, «title»: «Название по умолчанию», «option1»: «Название по умолчанию», «option2»: null, «option3»: null, «sku»: «», «requires_shipping»: true , «taxable»: false, «Feature_image»: null, «available»: true, «name»: «Ванна для волос из серебряной стали», «public_title»: null, «options»: [«Заголовок по умолчанию»], «price» : 3600, «вес»: 454, «compare_at_price»: null, «inventory_quantity»: 7, «inventory_management»: «shopify», «inventory_policy»: «deny», «barcode»: «8029352365430», «requires_selling_plan»: false , «sales_plan_allocations»: []}]

    Нетоксичный фиолетовый шампунь

    ЧТО ЭТО: Шампунь для окрашенных и мелированных волос

    ПОЧЕМУ ЭТО СПЕЦИАЛЬНО: Oway Silver Steel Hair Bath — это отгоняющий латунь шампунь, нейтрализующий нежелательные желтые и золотистые тона, делая волосы более яркими и сияющими.Биодинамический рис, органический репейник, этическая карамбола и фито-пептиды очищают и питают волосы изнутри, чтобы они выглядели здоровыми и сильными.

    Идеально для клиентов с седыми, светлыми и белыми волосами.

    ПОЛЕЗНО ЗНАТЬ :
    — Используйте 1-2 насосы ванны Silver Steel Hair. Пена. Оставьте на 1-5 минут в зависимости от желаемой интенсивности.

    НЕ СОДЕРЖИТ:
    ✕ Парабены
    ✕ SLS / SLES
    ✕ ГМО
    ✕ Нефть
    ✕ Фталаты
    ✕ Синтетический аромат
    ✕ ПЭГ, ППГ и БГ
    ✕ Искусственные красители

    ВОСКРЕСИТЕЛЬНЫЙ ЗАВОД: Это необычное растение способно выживать в чрезвычайно суровых и засушливых условиях из-за присутствия сахара, называемого трегалозой.Эта молекула защищает организмы от экстремальных условий, стабилизируя белки и сохраняя клеточные мембраны. В свою очередь, это оказывает регенерирующее, антиоксидантное, увлажняющее и защитное действие на волосы, кожу и кожу головы.

    Место обитания: Мексиканская пустыня

    ORGANIC MAQUI: Также называемая патагонской черникой, она считается самой мощной супер-ягодой, встречающейся в природе. Этот фрукт содержит дельфинидин, который производит клеточную энергию и замедляет процессы старения.

    Место обитания: Патагония

    ЭТИЧЕСКОЕ МАСЛО БАКУРИ: Богат витаминами A, B и C, антиоксидантами и минералами, это чрезвычайно питательное и естественное смягчающее средство для кожи и волос.

    Среда обитания: тропический лес

    ЦЕОЛИТ: Оказывает антистрессовое, реминерализирующее и детоксицирующее действие на кожу головы. Это особенно эффективно для чувствительной кожи.

    Среда обитания: вулканические почвы

    СИБИРСКИЙ ЖЕНСЕНЬ: Богат фитонутриентами, которые тонизируют, осветляют и наполняют кожу энергией.Известен своими антивозрастными свойствами.

    Место обитания: Сибирь и Монголия

    БИОФЕРМЕНТЫ: Эти замечательные техно-ботанические вещества обеспечивают волосы и кожу необходимыми питательными веществами. Они усиливают клеточную сплоченность тканей, делая их более прочными и компактными. Они также стимулируют восстановление и регенерацию кожи.

    ФИТО-ПЕПТИДЫ: Еще одно инновационное техно-ботаническое средство, его небольшой молекулярный вес обладает способностью глубоко кондиционировать и восстанавливать волокна волос изнутри.Его полностью естественное омолаживающее и уплотняющее действие придает волосам силу, объем и структуру.

    ГИАЛУРОНОВАЯ КИСЛОТА ИЗ РАСТЕНИЙ: Повышает гидратацию клеток, повышает эластичность кожи, уменьшает морщины, уплотняет и уплотняет кожу.

    Руководство по материалам из стали для ножниц

    : 14 лучших металлов

    Позвольте мне задать вам вопрос … «Какая сталь для ножниц самая лучшая и как узнать, что окупаются ваши деньги?»

    Звучит как простой вопрос, но это одна из самых запутанных частей при покупке новой пары парикмахерских ножниц или парикмахерских ножниц.

    Из какой стали сделаны мои ножницы? В чем разница между низкокачественной и высококачественной ножничной сталью?

    Различные типы стали для ножниц определяют:

    • Насколько острое у вас лезвие
    • Как легко затачивать
    • Устойчивость к ржавчине и коррозии
    • Насколько хрупкое и хрупкое лезвие
    • Насколько легки ножницы
    • Сколько лет прослужат ваши ножницы

    С учетом сказанного легче понять, почему вы платите 300 долларов за пару, а не 99 долларов.Если вы стригетесь почти каждый день, важно иметь правильные инструменты, которые служат долго и надежно работают.

    Что такое ножничная сталь и различные типы качества

    Действительно сложно понять, какая пара ножниц является хорошей сделкой, когда так много марок и моделей используют разные названия и типы стали. Итак, какие виды стали используются для изготовления парикмахерских и парикмахерских ножниц?

    Качество стали для ножниц

    определяется классом твердости по Роквеллу (HRC / HR).Что такое рейтинг Rockwell HRC?

    Короче говоря, он фокусируется на прочности ваших ножниц и их общей твердости. Чем тверже лезвие, тем оно лучше.

    Каждый вид стали — нержавеющая сталь. Марка нержавеющей стали, измеренная по шкале твердости Роквелла (HRC).

    Вот пример того, чего ожидать от некачественных и высококачественных парикмахерских и парикмахерских ножниц в Австралии.

    Твердость

    Уровень качества

    Ориентировочная цена

    50-55HRC

    Более низкое качество и более мягкое лезвие

    50–199 долларов США

    55-57HRC

    Нож для стрижки волос начального уровня

    99–299 долларов США

    57-59HRC

    Лезвие для стрижки волос среднего уровня.Более жесткие, устойчивые к ржавчине и легко затачиваются.

    $ 149-400

    58-60HRC

    Режущее полотно среднего и высокого качества. Прочный, прочный и легко затачиваемый.

    $ 249-800

    60-62HRC

    Высококачественное режущее лезвие. Чаще всего встречается в ножницах премиум-класса. Прочный, прочный, имеет сверхострую кромку лезвия и легко затачивается.

    299–1000 долл. США

    61-63HRC

    Режущее лезвие сверхвысокого качества. Нашел только в лучших ножницах.

    $ 700-1500

    Чем выше HRC, тем тверже материал, острее лезвие, тем оно устойчивее к коррозии, ржавчине и т. Д.

    HRC — не единственное соображение при выборе между высококачественными и низкокачественными ножницами.Качество и стандарты производства также определяют, насколько острыми и производительными будут ваши ножницы.

    Давайте начнем с просмотра всех самых популярных наименований ножниц из стали, чтобы вы могли лучше понять свои новые ножницы.

    Основное различие в качестве парикмахерских ножниц — это используемый металл (нержавеющая сталь) и общее качество изготовления.

    Разница между дешевым металлом и дорогим металлом, из которого делают ножницы для волос, может означать разницу в сотни тысяч долларов.

    Здесь мы объясним лучший металл для ножниц для стрижки волос и разберем качество наиболее распространенной стали, используемой для ножниц.

    Лучшая сталь для ножниц для стрижки волос

    Все ножницы изготовлены из нержавеющей стали, но лучшая сталь для парикмахерских ножниц — из Японии.

    Японская сталь, используемая для изготовления ножниц, дает более острые края, требует реже заточки и более легкий баланс, что обеспечивает идеальную эргономику.

    Самыми популярными японскими сталями для ножниц являются 440C, VG10 (VG-10), VG1 (VG-1) и Cobalt ATS314 (ATS-314).

    Better Metal Better Blades

    В японских ножницах

    используются лезвия с острыми выпуклыми краями, которые требуют закаленной стали премиум-класса. Это позволяет дольше удерживать на лезвии более острую кромку.

    Это улучшает все лезвия, но в большинстве профессиональных японских ножниц из высококачественной стали используются лезвия с выпуклой кромкой.

    Вам также потребуется реже заточка из-за высококачественной закаленной стали.

    Лучший металл Лучшая эргономика

    Сталь более высокого качества удивительно легкая.Эта более легкая сталь снимает давление с ваших пальцев, запястий, локтей и плеч во время резки.

    Better Metal, увеличенный срок службы ножниц

    Более качественная японская сталь означает, что ножницы будут более устойчивы к коррозии, ржавчине и другим общим проблемам.

    Ожидается, что японские стальные ножницы

    прослужат от пяти до десяти до двадцати лет или дольше при надлежащем техническом обслуживании.

    Откуда берется лучшая сталь для ножниц?

    Все ножницы изготовлены из нержавеющей стали, но самые качественные и лучшие ножницы из металла производятся в:

    1. Японская сталь : самое высокое качество в мире!
    2. German Steel : Сталь лучшего качества из Европы
    3. Корейская сталь : вторая лучшая сталь из Азии
    4. Тайваньская сталь : высококачественная сталь
    5. Китайская сталь : высококачественная сталь

    Худшая сталь производится в Индии, Пакистане и Вьетнаме.Эти индийские и пакистанские ножницы имеют тупые края, и обычно их можно заточить только один или два раза, прежде чем они сломаются.

    Топ 10 лучших ножниц для волос, сталь

    С таким большим количеством металлов, как нам узнать, какой из них лучше всего подходит для профессиональных парикмахерских и парикмахерских ножниц?

    Вот наша 10 лучших и худших парикмахерских ножниц из стали:

    Сталь Рейтинг Имя Описание
    № 1 Best Steel АТС-314 (АТС314) Чистая японская сталь с самым высоким содержанием кобальта, титана и ванадия.
    № 2 VG-10 (VG10) Золотой Высококачественная японская сталь с очень высоким содержанием титана и ванадия, предназначенная для лучших ножниц и ножей.
    № 3 В-10 (В10) Высокое содержание титана и ванадия, что придает дополнительную прочность режущим лезвиям.
    # 4 В-1 (В1) Ножницы начального уровня из титановой и ванадиевой стали для резки с острыми лезвиями.
    # 5 С-3 (С3) Сталь с высоким содержанием кобальта для острых режущих кромок.
    № 6 С-1 (С1) Кобальтовая сталь начального уровня для закаленных ножниц.
    # 7 440C Закаленная японская сталь, популярная для изготовления ножниц для волос премиум-класса.
    № 8 440A Стандартная нержавеющая сталь, используемая на большинстве основных лезвий.
    № 9 420 Дешевая нержавеющая сталь, используемая в большинстве ножниц и ножей.
    # 10 410 Самая дешевая широко используемая сталь, не рекомендуемая для профессиональных ножниц.

    Ванадий и титан повышают твердость и прочность ваших ножниц. Они также делают ножницы легче, поэтому ими легче резать.

    Кобальтовая сталь

    делает лезвия легче и прочнее. Кобальтовая сталь придает ножницам острую режущую кромку и удерживает ее дольше, а это означает, что вам не нужно затачивать ножницы так часто.

    14 лучших сталей для ножниц для волос

    Мы оценили лучшую сталь по качеству, оптимальной стоимости и ее способности хорошо работать на рынке. Всегда есть более качественная резка стали, но мы верны реальности, поскольку у каждого есть бюджет.

    Итак, вот лучшая сталь, созданная профессиональными парикмахерами и парикмахерами со всего мира!

    1. V-1 (V1): 64HRC

    Сталь V1 — одна из самых высококачественных сталей, используемых в парикмахерских и парикмахерских ножницах.V1 является усовершенствованием стали VG10, которая обеспечивает ножницы более твердыми лезвиями, повышенной прочностью и трещиностойкостью.

    От ножниц для волос со стальными лезвиями V1 можно ожидать высочайшего качества и, безусловно, высокой цены.

    2. ATS-314 (ATS314): 62-63HRC

    Изготовленная известной японской компанией Hitachi Metals, ATS-314 — это высококачественная сталь, используемая для производства парикмахерских и парикмахерских ножниц премиум-класса. Многие производители ножниц говорят об использовании стали ATS-314 или ATS314, но лишь немногие используют официальный металл, произведенный Hitachi в Японии.

    Сталь ATS-314 создает лезвие для ножниц премиум-класса с превосходной твердостью. Это гарантирует, что лезвие дольше остается острым и отлично удерживает острый выпуклый край или край лезвия в форме моллюска.

    3. VG-10 (VG10): 60HRC

    VG10 (VG-10), также известная как V Gold 10, сталь — это уникальный дизайн, разработанный Takefu Special Steel в Японии, который, как известно, используется в некоторых из лучших парикмахерских ножниц. Для резки используется нержавеющая сталь высочайшего качества, она устойчива к коррозии, истиранию и является одним из самых прочных металлов для ножниц для волос.

    Вы можете ожидать, что ваши ножницы VG10 будут иметь превосходно острое лезвие, такое как выпуклое, в форме моллюска или скошенное лезвие.

    VG10 отличается превосходной остротой, легкостью и используется в производстве высококачественных ножниц, но не ограничивается Японией, поскольку японские металлургические компании осуществляют экспорт на международном уровне.

    4. 10CR: 60-62HRC

    Если вы ищете модернизацию стали 440C или 8Cr13MoV, то сталь 10CR, также известная как «10Cr15CoMoV», создает ножницы премиум-класса для профессионального использования.

    Подобно Hitachi / Takefu VG10, сталь 10CR обеспечивает превосходную остроту по сравнению с парикмахерскими ножницами.

    Этот металлический ножничный станок отвечает всем требованиям, когда речь идет о прочности, сохранении остроты кромки лезвия, устойчивости к коррозии и износу, а также цене.

    Универсальная сталь премиум-класса для профессиональных парикмахерских и парикмахерских ножниц, не более 1000 долларов за пару.

    5. 440C: 58-60HRC

    440C — это сталь премиум-класса, которая обычно встречается в таких популярных брендах, как Yasaka.Это идеальный универсал по своей прочности, твердости и практическому использованию при ковке лезвий ножниц для стрижки волос.

    Хорошая новость заключается в том, что вы не ожидаете платить тысячи долларов за лезвия Japan 440C. Это идеальные профессиональные парикмахерские и парикмахерские ножницы с острым выпуклым лезвием.

    6. 8CR: 59-62HRC

    8CR, также известная как 8Cr14MoV или 8Cr13MoV, представляет собой надежную сталь, которая используется для изготовления высококачественных парикмахерских и парикмахерских ножниц.Подобно стали Hitachi 440C, которая превращает ножницы в профессиональный инструмент.

    Отлично удерживает лезвие лезвия, дольше сохраняет остроту ножниц. Устойчивость к коррозии и износу для долговечности.

    Идеальная сталь для универсальных ножниц, которая удовлетворит любого парикмахера или парикмахера.

    6. 7CR: 57-60HRC

    Более крупный и прочный брат стали 4CR, 7CR, также известный как 7Cr17MoV, обеспечивает хорошее удержание кромки лезвия, устойчивость к коррозии и износу, простоту заточки и в целом хороший материал для ножниц.

    Достаточно ли этого для парикмахерских или парикмахерских ножниц? Они идеально подходят для парикмахерских ножниц среднего класса, которые подходят для профессионалов, учеников и энтузиастов домашнего парикмахерского искусства.

    7. 420: 56-58HRC

    Ножницы

    420 из стали немного мягче, чем японские 440C, но подходят для средних ножниц для волос из Японии. Вы можете рассчитывать на более низкую цену, но они все равно будут хорошо работать для профессионалов.

    8. Нержавеющая легированная сталь: 55-58HRC

    Вся сталь, используемая при производстве парикмахерских ножниц, выполнена из нержавеющей стали.По сравнению с большинством других названных сталей, нержавеющая сталь — это общий термин, который не дает вам полного представления о качестве ножниц или ножниц, которые вы покупаете.

    Согласно исследованиям нескольких брендов в Австралии, изделия из нержавеющей стали обычно имеют твердость 55-58 HRC. Ножницы из нержавеющей стали стригут волосы, но вы можете ожидать, что они будут дешевле (99-200 долларов).

    9. S-3 (S3): 62HRC

    Редкая и уникальная сталь от Ясуки Сильвер в Японии.S3 предлагает превосходную твердость для режущих лезвий и в основном используется в поварских и кухонных ножах, но также встречается в некоторых парикмахерских ножницах и лезвиях для парикмахерских ножниц из Японии.

    Что можно ожидать от стали S3? Премиум твердость, устойчивость к коррозии и в целом высокопроизводительные ножницы для волос, созданные для профессионалов.

    10. 410: 56HRC

    410 — это простая нержавеющая сталь с хромом, обладающая превосходной стойкостью к износу, коррозии и повреждениям. Обычно встречается в парикмахерских ножницах среднего класса из Японии.

    11. Хромистая сталь: 53-56HRC

    Хромированная сталь

    бывает разных подкатегорий и, как правило, представляет собой сталь низкого и среднего класса, которая используется в ножницах из Германии или Европы. Известные бренды, такие как Jaguar, используют хромистую сталь при производстве своих ножниц для волос начального уровня.

    Отлично подходят для недорогих ножниц, они будут доступны по цене, а качество резкости лучше для лезвий со скошенной кромкой.

    12. 4Cr14MoV: 56-58HRC

    4Cr14MoV имеет те же характеристики, что и 4Cr13, и чаще встречается в парикмахерских ножницах из-за своей доступности.Встречается в парикмахерских ножницах среднего класса.

    Они хорошо подходят для парикмахерских ножниц среднего класса и очень распространены среди производителей ножниц, произведенных за пределами Японии.

    13. 3Cr13: 52-55HRC

    3Cr13 — это простая нержавеющая сталь из Китая, которая имеет такие же качества, как и популярный 420J2 (AUS 4). Обычная сталь, используемая в простых ножницах для стрижки волос, определенно не рекомендуется для филировочных ножниц.

    14. 4Cr13: 55-57HRC

    4Cr13, иначе известный как 40Cr13, представляет собой стандартную нержавеющую сталь, которая является более жестким и твердым братом 3Cr13.Более высокая прочность позволяет производителям ножниц изготавливать лезвия с более острыми выпуклыми или скошенными кромками.

    Стоит ли вам быть уверенным в ножницах из 4Cr13? Они будут работать как большинство парикмахерских или парикмахерских ножниц среднего класса, а твердость 55HRC + достаточно хороша, чтобы продолжать стрижку, не нарушая банк.

    Различия между низкокачественной сталью и высококачественной сталью

    Все ножницы изготовлены из нержавеющей стали, но лучшая сталь для парикмахерских ножниц — из Японии.

    Японская сталь, используемая для изготовления ножниц, дает более острые края, требует реже заточки и более легкий баланс, что обеспечивает идеальную эргономику.

    Самыми популярными японскими сталями для ножниц являются 440C, VG10 (VG-10), VG1 (VG-1) и Cobalt ATS314 (ATS-314).

    Лезвия Better Steel Better Blades

    В японских ножницах

    используются лезвия с острыми выпуклыми краями, которые требуют закаленной стали премиум-класса. Это позволяет дольше удерживать на лезвии более острую кромку.

    Это улучшает все лезвия, но в большинстве профессиональных японских ножниц из высококачественной стали используются лезвия с выпуклой кромкой.

    Вам также потребуется реже заточка из-за высококачественной закаленной стали.

    Лучшая сталь Лучшая эргономика

    Сталь более высокого качества удивительно легкая. Эта более легкая сталь снимает давление с ваших пальцев, запястий, локтей и плеч во время резки.

    Better Metal Longer Scissor Life

    Более качественная японская сталь означает, что ножницы будут более устойчивы к коррозии, ржавчине и другим общим проблемам.

    Ожидается, что японские стальные ножницы

    прослужат от пяти до десяти до двадцати лет или дольше при надлежащем техническом обслуживании.

    Подробнее о низком и высоком качестве стали для ножниц здесь.

    Откуда взялась лучшая сталь для ножниц?

    Лучшая сталь для ножниц поступает из Японии, Германии и Китая. Сталь высочайшего качества производится в Японии и является причиной международного ажиотажа вокруг японских парикмахерских ножниц.

    Германия производит высококачественную хромистую сталь, благодаря чему успешные бренды ножниц, такие как Jaguar Solingen, могут покорить мир своими качественными инструментами для стрижки волос.

    Китай производит высококачественную сталь оптом и вопреки распространенному мнению, по качеству может конкурировать с Японией и Германией. У них также есть лучшая сталь для профессионалов по превосходной доступной цене.

    Подробнее о лучшем металле для ножниц для стрижки волос здесь.

    Часто задаваемые вопросы о стальных ножницах

    Здесь мы собрали список наиболее часто задаваемых вопросов о стали и металлах, используемых для изготовления парикмахерских и парикмахерских ножниц.

    • Вопрос : Какую ножничную сталь я должен купить?
      Ответ: Мы получаем много звонков и писем о том, какая сталь для ножниц является лучшей, и это действительно зависит от вашего бюджета. Лучшим качеством будет V1, VG10 или ATS314, но это также может стоить вам 1000 долларов за пару. Для получения наилучшего результата вы можете сосредоточиться на парах с твердостью 58HRC и выше.
    • Вопрос : Стоит ли покупать ножницы из титановой стали?
      Ответ: Ножницы из титановой стали немного вводят в заблуждение, поскольку они, как правило, представляют собой цветное покрытие или, возможно, являются небольшим ингредиентом при создании стали.Сосредоточьтесь на HRC, который определяет твердость стали для ножниц, и тогда вы сможете найти инструмент для стрижки волос, который соответствует вашим потребностям.
    • Вопрос : Какая сталь самая лучшая с ограниченным бюджетом?
      Ответ: Сталь 440С — лучшая японская сталь с ограниченным бюджетом. В противном случае высококачественные ножницы из нержавеющей стали с 56HRC были бы доступными и достаточно эффективными для стрижки волос.
    • Вопрос : Как выбрать парикмахерские ножницы?
      Ответ: Ключевым отличием ножниц, влияющим на цену и качество пары, является сталь.Сталь более высокого качества стоит дороже, но она делает ножницы для стрижки более острыми, долговечными и в целом качественной покупкой.
    • Вопрос : Как избежать поддельной или низкокачественной стали из Китая или Пакистана?
      Ответ: Пакистан определенно имеет ножницы самого низкого качества из стали, и мы рекомендуем избегать этих ножниц. В китайской стали столько же премиальных марок, сколько и некачественных. Мы рекомендуем избегать Amazon, eBay и Wish и сосредоточиться на авторитетных веб-сайтах, которые предлагают гарантию и гарантию обмена.Это позволит вам опробовать свои новые ножницы, чтобы затем понять качество ножниц.

    Здесь мы составили список наиболее часто задаваемых вопросов о стали и металлах, используемых для изготовления парикмахерских и парикмахерских ножниц.

    Ножничные стальные премиум-класса

    Дамасская сталь

    Порошковая сталь

    Вопрос Ответ
    Какая наиболее распространенная сталь для парикмахерских ножниц? Самый распространенный металл, используемый для изготовления ножниц для волос, — это нержавеющая сталь 440C.
    Какая сталь для парикмахерских ножниц лучше всего подходит для профессионалов? Рекомендуемый металл для волос ножниц из японской стали 440С.
    Какой металл лучше всего подходит для студентов-парикмахеров? Сталь 440A идеально подходит для ножниц для волос начального уровня.
    Существуют ли ножницы из чистого 100% титана? 100% титан не используется для изготовления ножниц, но вы можете получить ножницы с содержанием от 2% до 10%.
    Что такое нержавеющая сталь? Нержавеющая сталь — это металл, используемый для всех лезвий.Он бывает разных типов, причем более качественные версии сложнее.
    Какой металл лучше всего подходит для ножниц для волос? ATS-314 или VG-10 из Японии.
    Существует ли дамасская ножничная сталь? не производилась более 300 лет. Дамасская сталь, используемая для изготовления ножниц для волос, — это просто дизайн.
    Титановые ножницы лучше? Титан добавлен в ножничную сталь для повышения прочности и прочности лезвия.Титан встречается только в ножницах высшего качества. Лезвия ножниц из титана более острые, легкие и качественные.
    Что такое нержавеющая сталь 6cr? Сталь 6CR, также известная как сталь «6CR13MoV», содержит углеродную добавку 0,66 к металлу и используется для изготовления основных режущих инструментов.
    Что такое нержавеющая сталь 9cr? 9CR, иначе известная как «9Cr13MoVCo» или «9Cr18MoV», представляет собой китайскую сталь более высокого качества, используемую для парикмахерских и парикмахерских ножниц.
    Что такое ножницы с титановым покрытием? Титановое покрытие парикмахерских ножниц предназначено только для укладки и не улучшает качество или остроту стрижки волос.
    Порошковая сталь для ножниц хороша? — это высококачественный металл, выкованный по уникальной технологии. Ножницы из порошковой стали имеют высококачественные острые лезвия, легкую конструкцию и устойчивы к ржавчине и коррозии. Ножницы Powder Scissor Steel сравнимы с японскими ножницами Hitachi ATS314 и Takefu VG10 с их превосходными краями и эргономичной легкой конструкцией.

    Реальность такова, что никакие ножницы не остаются острыми вечно, и никакая сталь не является полностью ржавой, устойчивой к физическим повреждениям и коррозии навсегда.

    Но когда вы дойдете до уровней 440C, VG1 / 10, Cobalt и ATS-314, можете быть уверены, что эти ножницы будут надежными и достаточно прочными, чтобы прослужить много лет вперед.

    Парикмахерская Steel Roots | Клеммонс, Северная Каролина

    5 звезд


    Заказчик с 2018 года

    Как всегда отлично

    5 звезд


    Проверенный клиент

    Замечательный сервис и выдающиеся результаты! Люблю мирную атмосферу.

    5 звезд


    Заказчик с 2019 г.

    Отличный сервис и Бейли великолепен. Лучшее место, чтобы правильно уложить волосы. Все очень милы.

    5 звезд


    Проверенный клиент

    Они смогли прогуляться.Джулия очень помогла, когда рассказала о прическах, которые мне подойдут, и о том, как их укладывать.

    5 звезд


    Заказчик с 2020 г.

    Отличная стрижка и цвет. Приятная обстановка и приветливый персонал.

    5 звезд


    Заказчик с 2021 г.

    Тина была великолепна.Очень симпатичный и простой в общении. Она выслушала то, что я искал, дала несколько рекомендаций и согласилась с этим. Я так доволен своим цветом и стрижкой.

    5 звезд


    Проверенный клиент

    Тина всегда получает то, что я хочу, и делает именно это!

    5 звезд


    Заказчик с 2021 г.

    Миранда — отличная девочка, и мне нравятся мои волосы.. Все очень дружелюбны ..

    5 звезд


    Проверенный клиент

    Жестяные банки для волос. Отличная цветная работа!

    5 звезд


    Заказчик с 2021 г.

    Миранда проделала потрясающую работу! Обожаю свой цвет и стиль! Большое спасибо, Миранда!

    Показать больше обзоров

    404 СТРАНИЦА НЕ НАЙДЕНА | CELINE

    ГРАЖДАНСТВО / ПАСПОРТ (ДОПОЛНИТЕЛЬНО)

    Предпочитают не SAYAFGHANISTANALAND ISLANDSALBANIAALGERIAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA И BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABONAIRE, СЕН Эстатиус и SABABOSNIA И HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH ИНДИЙСКОГО ОКЕАН TERRITORYBRITISH ВИРГИНСКОГО ISLANDSBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL АФРИКАНСКОГО REPUBLICCHADCHILECHRISTMAS ISLANDCOCOS (Keeling) ISLANDSCOLOMBIACOMOROSCONGO (Демократическая Республика) Конго (Республика) КУК ISLANDSCOSTA RICACROATIACUBACURAÇAOCYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDSFAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH ПОЛИНЕЗИЯФРАНЦУЗСКИЕ ЮЖНЫЕ ТЕРРИТОРИИГАБОНГАМБИЯГЕОРГИЯГЕРМАНИЯГАНАГИБРАЛТАРГРЕЭЦЕГРЕНЛАНДИЯГРЕНАДАГАДЕЛОУПЕГУАТЕМАЛАГЕРНСЕЙГИНЕАГВИНА-БИССАУГЯНАХАЙТИХАВАЙ ISLANDSHONDURASHONG ГОНКОНГ САР PRCHUNGARYICELANDINDIAINDONESIAIRAN (Исламская Республика) IRAQIRELANDISLE ИЗ MANISRAELITALYIVORY COASTJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA, ДЕМОКРАТИЧЕСКАЯ НАРОДНАЯ РЕСПУБЛИКА OFKOREA, РЕСПУБЛИКА OFKUWAITKYRGYZSTANLAOS, ЛАО НАРОДНАЯ ДЕМОКРАТИЧЕСКАЯ REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYALIECHTENSTEINLITHUANIALUXEMBOURGMACAU САР PRCMACEDONIAMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMOLDOVAMONACOMONGOLIAMONTENEGROMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORWAYOMANPAKISTANPALESTINIAN TERRITORYPANAMAPAPUA НОВЫЙ GUINEAPARAGUAYPEOPLE Республики CHINAPERUPHILIPPINESPITCAIRNPOLANDPORTUGALQATARREUNIONROMANIARUSSIARWANDASAINT BARTHELEMYSAINT Helena, восхождению и TRISTAN DA CUNHASAINT Киттс и NEVISSAINT ЛЮСИАСЕН МАРТИН (ФРАНЦУЗСКАЯ ЧАСТЬ) СЕНТ-ПЬЕР И МИКЕЛОНСЕН ВИНСЕНТ И ГРЕНАЦИОНСКИЙ ТОМ МАРИНОСАО И ПРИНЦИПЕСАУДИ А RABIASENEGALSERBIASEYCHELLESSIERRA LEONESINGAPORESINT МАРТЕН (ГОЛЛАНДСКАЯ ЧАСТЬ) SLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH ГРУЗИЯ И Южные Сандвичевы ISLANDSSOUTH SUDANSPAINSRI LANKASUDANSURINAMESVALBARD И ЯН MAYENSWAZILANDSWEDENSWITZERLANDSYRIA (Арабская Республика) ТАЙВАНЬ REGIONTAJIKISTANTANZANIATHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD И TOBAGOTUNISIATURKEYTURKMENISTANTURKS И КАЙКОС ISLANDSTUVALUUGANDAUKRAINEUNITED АРАБ EMIRATESUNITED KINGDOMUNITED STATESURUGUAYUZBEKISTANVANUATUVATICANVENEZUELAVIETNAMWALLIS И FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWE

    Steel Beauty® | Повышает коллаген | Всего 39 долларов.95

    Витамин А (в виде бета-каротина): Бета-каротин превращается в организме в витамин А, мощный антиоксидант, который играет важную роль в поддержании здоровья зрения, кожи и неврологических функций. *

    Витамин C (как аскорбиновая кислота): Витамин C — водорастворимый витамин, который действует как антиоксидант, помогая бороться с окислительным стрессом, а также способствует синтезу коллагена. *

    Витамин D3 (как холекальциферол): Витамин D — это гормон, который играет важную роль в гомеостазе кальция, иммунной регуляции и дифференцировке роста клеток.Антиоксиданты, присутствующие в витамине D, предотвращают повреждение кожи и преждевременное старение, а витамин D также является предшественником цикла роста волос. *

    Витамин E (сукцинат d-альфа-токофериловой кислоты): Витамин E разрушает группу жирорастворимых соединений, известных как токоферолы и токотриенолы. Витамин Е улучшает кровообращение и защищает клетки от вредных свободных радикалов, действуя как антиоксидант. *

    Биотин: Также известный как витамин B7, биотин действует в организме как кофермент, необходимый для метаболизма жирных кислот, аминокислот и глюкозы.Витамин B7 необходим для поддержания здоровья кожи, волос и ногтей. *

    Пантотеновая кислота: Также известная как витамин B5, пантотеновая кислота является важным питательным веществом, необходимым для метаболизма пищевых углеводов, белков и жиров, потребляемых ежедневно. Витамин B5 имеет решающее значение для роста и дифференциации кератина и коллагена. *

    Цинк (как пиколинат цинка): Цинк является элементом и важным микроэлементом, участвующим во многих биологических процессах, включая иммунитет, функцию мозга, синтез белков и ДНК, а также репродукцию.Цинк является важным сопутствующим фактором для множества ферментов и участвует в важной функциональной активности волосяного фолликула. Пиколинат цинка — это кислотная форма цинка, которая легко усваивается. *

    BioCell Collagen® (запатентованный экстракт куриного грудного хряща): BioCell Collagen® — это научно обоснованный, клинически проверенный диетический ингредиент, который способствует активным суставам, молодости кожи и здоровым соединительным тканям. В отличие от других ингредиентов коллагена и гиалуроновой кислоты, представленных на рынке, BioCell Collagen® содержит запатентованную композицию природного гидролизованного коллагена типа II, хондроитинсульфата и гиалуроновой кислоты в форме хорошо усваиваемого матрикса, которая была предметом многочисленных клинических испытаний на людях, в том числе безопасность, эффективность и биодоступность.*

    Линолевая кислота (как сафлоровое масло) ( Carthamus Tinctorius ): Омега-6 незаменимая жирная кислота, линолевая кислота помогает улучшить качество и внешний вид вашей кожи. Линолевая кислота обеспечивает противовоспалительную, увлажняющую и заживляющую поддержку. *

    Экстракт зеленого чая ( Camellia Sinensis ) (80% катехинов и 50% EGCG): Естественно богатые антиоксидантами полифенолы в зеленом чае помогают защитить кожу от вызванных ультрафиолетом B-излучения заболеваний кожи, связанных с подавлением иммунитета и повреждением ДНК. обеспечивает постоянный приток кислорода и питательных веществ к нашим волосам, коже и ногтям.*

    Juvecol® (Протеогликан): Протеогликаны являются компонентом соединительных тканей, таких как кости, хрящи и кожа. Juvecol, сделанный из протеогликанов, извлеченных из хряща лосося, является отмеченным наградой NEXTY ингредиентом, клинически подтвержденным для поддержания здоровья суставов и красоты кожи. *

    Ресвератрол ( Polygonum Cuspidatum ): Ресвератрол является частью группы соединений, называемых полифенолами. Ресвератрол обладает мощным антиоксидантным действием, поддерживает здоровье на клеточном уровне и защищает от симптомов, связанных со старением и повреждением свободными радикалами.*

    .

    Оставьте комментарий